LL-37 Research Peptide 5mg (10 vials)

HPLC tested

Mass spec verified

COA per batch

$108.00

LL-37 research peptide, 10 vials x 5mg. Lyophilized with batch COA. For laboratory research use only.

Free shipping

US $200+ · Intl $450+

COA per batch

Lookup by lot number

Secure checkout

Encrypted payment

SKU 375 Category Research Peptides

For research use only

Sold for in vitro and laboratory research. Not for human or veterinary use. Not a drug, food, supplement or cosmetic.

Overview

Product details

LL-37 is a synthetic 37-amino-acid cathelicidin-derived peptide. It is supplied as lyophilized (freeze-dried) powder. This pack contains 10 sealed vials, each holding 5mg.

Identification

Sequence: [LL-37, 37 aa]
Molecular weight: approx. 4493 g/mol
Format: lyophilized (freeze-dried) powder, 10 vials x 5mg

Documentation: each batch is tested by our manufacturer’s quality control laboratory for HPLC purity and mass spectrometry identity. Find your batch in COA Lookup, or read our guide on how to read a peptide COA.

Storage: keep sealed at -20 °C, protected from light and moisture.

For laboratory research use only. Not for human or veterinary use.

Specifications

Format	sealed research vial pack
Size	5mg x 10 vials
SKU	375
Purity target	see batch COA where available
Storage	review product label and batch documentation
Documentation	COA available by request
Use	Laboratory research use only

Research use

This product is sold strictly for laboratory research use only. It is not intended for human consumption, clinical use, veterinary use, diagnostic use, food use, cosmetic use, drug use, supplement use, or therapeutic use.

Documentation